Home   Recent Questions   Testimonials   FAQs


This question was answered on Sun 16, May 2010 11:55pm by Online Doctor

Does fibroid tumors move around in uterine


    
Asked by Unregistered (Female; 21; YES; Fibriod tumors ) on Sat 15, May 2010 11:22pm

Does fibroid tumors move around in uterine

Actions: | Forward |
Answer


Name 

Email 

Security code
Enter the text as shown above


E-Mail me when someone replies to this post
Answer by Online Doctor  on Sun 16, May 2010 11:55pm:

Dear Kiesha fibroids are benign tumors which originate from muscle layer and connective tissue of the uterus.They donot move but can increase in size,they can be located in the various layers of the uterus like the inner layer,middle layer,outer layer and cervical region.You have to do a ultrasonography to know about location and get in touch with a doctor.Take care.

Detailed answer for your question: Available in paid version. - Click to pay.
Second opinion from another doctor: Available in paid version. - Click to pay.
               
Our doctors provide free answers to your questions. If you are happy with our services, please consider making a donation.
Click the button below to donate.


Please rate my answer (select the stars, no need to log in.)  

This question is open for comments.  Please share your opinion.

Comments


Name 

Email 

Security code
Enter the text as shown above


E-Mail me when someone replies to this post
Other cancer questions you might be interested in.
  1. pain meds versus liver damage  (Answered) - Viewed 5013 times   My 57yo brother in law was diagnosed in October with lung cancer with mets to the bones, brain and liver. His lung ca was Stage...
  2. Benign brain tumors - Can benign tumors have so called 'seeds' that can break off and spread  (Answered) - Viewed 3159 times   Our 17 yr. old host son was diagnosed with two brain tumors. A biopsy performed in Korea showed they were benign. They did not ...
  3. Squamous Cell Cancer - Inoperable squamous cell cancer and prognosis  (Answered) - Viewed 2948 times   My husband has been diagnosed with Squamous Cell Cancer. He has 3 tumors in his lymph gland of his neck, 2 in his shoulder blad...
  4. Should I move up my Surgery dates with these symptoms of ovarian cancer  (Answered) - Viewed 1486 times   I have a fibroid uterus, small cyst on my ovary, CA-125 level is 102. and my D-Dimer is elavated to 2.3. My doctor is not concer...
  5. enlargement on the tip one side of collarbone. No pain. Feels like bone.  (Answered) - Viewed 3001 times   I just noticed an enlargement on one side of my collarbone. It is hard and does not move. It does not hurt.I had stage 1 uterine...
  6. Stage 1 Breast Cancer - ER Positive PR positive HER2 positive  (Answered) - Viewed 3177 times   I was diagnosed in October 2006 at age 48 with stage 1 breast cancer - 1.7 cm. & 1.0 cm. tumors in right breast, 16 negative nod...
  7. How long will a Anaplastic Oligoastrocytoma patient live - she is going through radiation & Chemo (post surgery) but still has 3 more tumors & has seizures & vomitting??  (Answered) - Viewed 1915 times   - How long will a Anaplastic Oligoastrocytoma patient live - she is going through radiation & Chemo (post surgery) but still ha...
  8. abdominal pain lowgrade fever back pain, is this linked to fibroid or cancer symptoms  (Answered) - Viewed 1805 times   baby 6 months ago. diagnosed with a fibroid measuring 8 by 10 cm. Have been having other symptoms more recnently. pain in my lef...
  9. stress fractures in legs along with bome tumors in legs and now spots on chest, left elbow and jaw  (Answered) - Viewed 1334 times   My son was diagonosed with stress fractures inboth legs and bone tumors. Now there doing test and found "spots" on the chest cav...
  10. Stress fractures and bone tumors in both legs now spots are found in the chest area along with the left elbow, neck and jaw.  (Answered) - Viewed 2012 times   My son has stress fractures and bone tumors in both legs. Now, they did scans, MRIs and blood test and found that he has "spots"...
  11. OnTamoxifen for DCIS. Periods are two days long but vary from 18-45 days between. Have pre-DCIS fibroids. Are 18 days between a problem?  (Answered) - Viewed 1471 times     My cycles come every 28-45 days on tamoxifen. They are about two days long, sometimes spotting starts for a couple of days ...

 
What users are searching right now on Ask an oncologist now:
melanoma20in20lungs     teitz Syndtome     how252520long252520ago252520did252520lung252520cancer252520first252520happen     Abdominalbloatingnauseaweight     ihavealwayshadaverypaleraisedmole     How long does Mitomycin C remain in the system I had an extravasion following an intravesical in fusion of Metomycin resulting in holes in the bladder and systemic side effects predominately almost total hair loss The surgery was 3 weeks ago     body20piercings     monoclonal protein with kappa light chain     canabdtumorsgrowduringwholdabdradiation     hepatoblastoma     what20is20meant20by20having20an20abnormal20protein20band     how20big20is20big     8mmsolidfindingwithcolorflowbelowrightear10x4x14mmnodulardensitylateralrightneck     porno     left252520eye252520swallen252520and252520side252520of252520face252520swallen     WHATISMATASIZE     blood20total20protein     liver20low20wbc20high20lymphocytes     direct transperitoneal cancer spread     after herceptin treatment combined with stroid and puraton i suffered tightness under the left breast and hot and cold and tired is this normal reaction     waldenstrams     Bloom Richardson Scoring system     multiple mylenoma     new     breast cancer staging pt1c     Two Igm Monoclonal Antibodies immunofixation Protein     swollen glands in the throat difficulty swallowing feels like something stuck in my throat     her     IgA kappa     whatcanidotomakemybreastgrow     pma     WHAT IS MATASIZE     Search for answers     lymph nodes     persistantcoughwithmultiplemyeloma     Search for answers     Lymphomapeasizedrubberytohardnoduleabovejawlin     retroperitoniallipoma     ihavejustfoundapurpledarklumpkindalookslikealittlesackjustinbetwe292620Enter20your20comments20here20deposit     what20is20a20igg20lambda20monoclonal20band     sweeling20on20right20testical20cord     a small lump on the upper right side of my back     are20bone20cyst20related20to20osteoporosis     logs     asklungcancerquestions     lung cancer and leg pain     mild252520enhancement     what is an oncologist do     igg kappa monoclonal protein detected igg     MONOCLONAL     multiplemyelomaiggkappa     vulvar20vancer     faintbandiniggandlambada     igotalivercystisliverc     removal of a fibrodenoma     blisterongums     broad20Gamma20band     lungharatomsaandlungnacer     my brothers lamda light chains elevated from 12 to 144 what does this indicate     Can I take tamoxifen and hcg     low20concentration20monoclonal20igG20KAPPA     what20cells20does20lung20cancer20start20in     is20it20safe20to20take20vitamin20tablets20whilst20having20chemo     enlarged pancreas     IgG kappa monoclonal bands     lymphnodesmonspubis     igg kapa monoclonal imunoglobulin migrating in the gamma region     What20is20k20ras20mutation20in20lung20cancer     m     using a sitz bath to onplug stool     ihavejustnoticedasmallsoftlumponthetopofmyle     speckled20ANA     small20round20pink20knot20on20the20nose     radial20scar20breast     BUNhigh     README     hypoechoic20well20defined20masses20in20right20pericaval20region20majours20abput205020202720cms     vulvarvancer     tender mass in arm     resuming anal intercourse after chemoradiation for anal cancer     Ana20postive     staging20for20multiple20myeloma     is ensure good for people suffering cancer     stage 2a     Scattered20nonspecific20nonenlarged20cervical20lymph20nodes     faintIGGKappamonoclonali     d     ResultArrodejed     lungcancerandlegpain     ovarian cancer 3 prognossis     I20have20been20diagnosed20with20Atypical20Ductal20Hyperplasia20will20my20sons20need20to20be20concerned     Bilateralmastectomy     recovery     hip     LUNG20CANCER     6mmspotonpancreas     Krohns disease     pst menopausal ovanian cyst     I20HAVE20LUMP20TO20RIGHT20OF20TESTICLES     ductalcarcinomainsituhighgradesolidpatternwithfocalindividualcellnecrosisbutnoevidenceofcomedonecrosis     

©2011 - Ask an oncologist now  |  All Rights Reserved
The site is not a replacement for professional medical opinion, examination, diagnosis or treatment. Always seek the advice of your medical doctor or other qualified health professional before starting any new treatment or making any changes to existing treatment. Do not delay seeking or disregard medical advice based on information written by any author on this site. No health questions and information on askanoncologistnow is regulated or evaluated by the Food and Drug Administration and therefore the information should not be used to diagnose, treat, cure or prevent any disease without the supervision of a medical doctor. Posts made to these forums express the views and opinions of the author, and not the administrators, moderators, or editorial staff and hence askanoncologistnow and its principals will accept no liabilities or responsibilities for the statements made.

Home | Terms & Conditions | Contact Us | Frequently Asked Questions | Disclaimer | Privacy Policy | Advertise with us
Stats