Home   Recent Questions   Testimonials   FAQs


This question was answered on Sun 14, Sep 2008 03:06am by Dr Paul S, MD

Hands hurt when urinating


    
Asked by greasefanatic (Male; 81; Prostrate cancer treated over 5 years ago without reoccurance. Last prostrate screening within the past few months.; Relevant drugs:Unsure ) on Sat 13, Sep 2008 10:37pm

My 81 year old grandfather recently began having strong pain is his hands when he urinates. The pain starts at his finger tips and goes up to his hands. He has no other symptoms and has already been tested for prostate cancer. What could this be?

Actions: | Forward |
Answer


Name 

Email 

Security code
Enter the text as shown above


E-Mail me when someone replies to this post
Answer by Dr Paul S, MD  on Sun 14, Sep 2008 03:06am:

Hi there. This description of pain is most likely neuropathic, which means that the nerves are primarily involved. This may be due to stress, nutritional deficiencies (such as B vitamins) or the natural ageing process. Other causes would include electrolyte imbalances (calcium, potassium, magnesium) which can also be nutritional in origin. Supplementation and drugs like gabapentin or pregabalin would usually address neuropathic pain. Nevertheless, I would suggest that he have this evaluated by his doctors, possibly check the levels of electrolytes and vitamins in the blood. Regards.

Detailed answer for your question: Available in paid version. - Click to pay.
Second opinion from another doctor: Available in paid version. - Click to pay.
               
Our doctors provide free answers to your questions. If you are happy with our services, please consider making a donation.
Click the button below to donate.


Please rate my answer (select the stars, no need to log in.)  

This question is open for comments.  Please share your opinion.

Comments


Name 

Email 

Security code
Enter the text as shown above


E-Mail me when someone replies to this post
Other cancer questions you might be interested in.
  1. cancer - lost 10 lbs in 3 weeks without trying: Chances of cancer  (Answered) - Viewed 3627 times   lost 10 lbs in 3 weeks without trying, urinating at night 3 times after going to bed, CT of head pelvis neg. ct of liver show tw...
  2. stage 3 colon cancer - chances of recurrence and treatment options  (Answered) - Viewed 4408 times   In July of 2007 my husband had a colon resection done with about 1.5 feet of his colon removed due to stage 4 colon cancer (sigm...
  3. PROSTATE CANCER - PSA and Gleason score doesnt reveal spread of cancer to bones  (Answered) - Viewed 3567 times   I WENT TO MY DOCTOR APPROX 5-6 MONTHS AGO BECAUSE MY LEFT SIDE NECK AND ARM WAS STIFF. MY DOCTOR SAID I HAD A PINCHED NERVE AND ...
  4. got app. with an oncologist for swollen lymph node that hadnt went away what does it sound like  (Answered) - Viewed 2316 times   hi,about one month ago i was at my dr.for a check up and told him i had a painless swollen lump on my neck that just came up a w...
  5. Internal cancers that are not detected by bloodwork  (Answered) - Viewed 1071 times   I have a redness and sometimes dry patches on arms hands, shin and feet...dermatologists are unsure of its origin....What intern...
  6. Followup scans not being done on synovial sarcoma of the neck  (Answered) - Viewed 1577 times   what do you know about synovial sarcoma of the neck. I had a 5 cm tumor removed from inbetween my carotid artery and my jugular...
  7. stage 3 colon cancer - chances of recurrence and treatment options  (Answered) - Viewed 1391 times   In July of 2007 my husband had a colon resection done with about 1.5 feet of his colon removed due to stage 4 colon cancer (sigm...
  8. PROSTATE CANCER - PSA and Gleason score doesnt reveal spread of cancer to bones  (Answered) - Viewed 2746 times   I WENT TO MY DOCTOR APPROX 5-6 MONTHS AGO BECAUSE MY LEFT SIDE NECK AND ARM WAS STIFF. MY DOCTOR SAID I HAD A PINCHED NERVE AND ...
  9. cancer - lost 10 lbs in 3 weeks without trying: Chances of cancer  (Answered) - Viewed 1105 times   lost 10 lbs in 3 weeks without trying, urinating at night 3 times after going to bed, CT of head pelvis neg. ct of liver show tw...
  10. Constant pain in hands and feet, with tumors in feet  (Answered) - Viewed 1100 times   In the last I'd say 4 yrs there has been a growing problem with my feet and hands, they are constantly in pain. The more I use ...
  11. frequent periods-pregnancy symtoms but no tubes-can feel when I ovulate and clear liquid comes from breast- what is it?  (Answered) - Viewed 1714 times   30yrs old, 3 healthy kids, healthy pregnancies, tubal lig. pomeroy at 21 reversal aat 27 3 ect. preg resulting in removal of bot...

 
What users are searching right now on Ask an oncologist now:
PleasehelpmewithananswerEnlargedglandsunderlef     lowwbclowrbclowhemoglobinlowhematocrithighmch     recovery     how20to20read20a20colon20ct20scan     Search for answers     Search for answers     Search for answers     Search for answers     Search for answers     Search for answers     asklungcancerquestions     Myeloma     Arms     IG20G20Lambda20protein     Mesentery2Blymphoma     spiculat     heart20failur     Omasom     Omasom     Search for answers     Cottonunderskin     her     secondarybonecancer     Search for answers     Search for answers     Search for answers     Search for answers     p120 catenin     high20iga     Search for answers     Search for answers     pth20peptide     Search for answers     Search for answers     Search for answers     Search for answers     Search for answers     Search for answers     lymphoma20of20the20jaw     Search for answers     Search for answers     ihaveabump     poorlydifferintiatedlungcancer     furuncles     lymphoma20symptoms     my oncologist is not worried     PTEN     Omasom     bartholinscarcinomalymphoma     asklungcancerquestions     lumponmyribcage157220inurl20post20a20new20comment20lipoma     is20it20safe20to20take20vitamin20tablets20whilst20having20chemo     Search for answers     Search for answers     i20have20been20diagnosed20with20atypical20ductal20hyperplasia20will20my20sons20need20to20be20concerned     Search for answers     Search for answers     lymphoma     Search for answers     Search for answers     Search for answers     Search for answers     bukol a cancerous ba     recurrence     CSF20PROTEIN     liver cyst     search     1     search     IgMkappamonoclonalbandpresent     iga monoclonal protein with lambda lihtchain     temperature and shivers with overian cancer     Search for answers     What20is20invasive20mammary20carcinoma20with20intermixed20lymphocytes     bile20duct20hamartoma     Alpha20120in20urine     columnar metaplasia     Tailbone pain and prostate cancer     igm monoclonal kappa     Search for answers     Search for answers     Search for answers     Search for answers     vaginaandrectumlump     ihavealwayshadaverypaleraisedmole     chancesofsurviving     trombocitopenia     angiosarcoma     mainstream20smoke     is20a20vascular20mass20in20neck20cancer     askhead20neckcancerquestions     ca19252520bloating     waiting20for20lumpectomy     shape stool     Lungnodule     hodgkin     Lump in breast painful breast     abnormal20pap     asklungcancerquestions     Epstein20Barr20Virus     

©2011 - Ask an oncologist now  |  All Rights Reserved
The site is not a replacement for professional medical opinion, examination, diagnosis or treatment. Always seek the advice of your medical doctor or other qualified health professional before starting any new treatment or making any changes to existing treatment. Do not delay seeking or disregard medical advice based on information written by any author on this site. No health questions and information on askanoncologistnow is regulated or evaluated by the Food and Drug Administration and therefore the information should not be used to diagnose, treat, cure or prevent any disease without the supervision of a medical doctor. Posts made to these forums express the views and opinions of the author, and not the administrators, moderators, or editorial staff and hence askanoncologistnow and its principals will accept no liabilities or responsibilities for the statements made.

Home | Terms & Conditions | Contact Us | Frequently Asked Questions | Disclaimer | Privacy Policy | Advertise with us
Stats