Home   Recent Questions   Testimonials   FAQs


This question was answered on Thu 15, Mar 2012 12:06pm by Dr. Kumar

Kappa/Lambda ratio


    
Asked by hopefaith2 (Female ) on Fri 29, Apr 2011 03:45pm

Hi my kappa is .15 my lambda us .88 and my ratio is .17. Is this something to worry about? My IGg is 1000 normal, IGa 114 normal, and is IGm all normal. I have had 2 very differeng opinions.

Actions: | Forward |
Answer


Name 

Email 

Security code
Enter the text as shown above


E-Mail me when someone replies to this post
Answer by Dr. Kumar  on Thu 15, Mar 2012 12:06pm:

Hello, Your questions are incomplete. What is your bone marrow report? what is skeletal survey? Why were these test asked for? God bless,all the best

Detailed answer for your question: Available in paid version. - Click to pay.
Second opinion from another doctor: Available in paid version. - Click to pay.
               
Our doctors provide free answers to your questions. If you are happy with our services, please consider making a donation.
Click the button below to donate.


Please rate my answer (select the stars, no need to log in.)  

This question is open for comments.  Please share your opinion.

Comments


Name 

Email 

Security code
Enter the text as shown above


E-Mail me when someone replies to this post
Other cancer questions you might be interested in.
  1. possibility of MM?  (Answered) - Viewed 2395 times   I had a cbc done on 02/11/08 because of a tooth infection and a bad cold. ( I had a root canal done the following week). On 3/16...
  2. Serum Immunofixation test result - What does IgG Kappa monoclonal protein detected in serum immunofixation test mean?  (Answered) - Viewed 83439 times   What does IgG Kappa monoclonal protein detected in serum immunofixation test mean? This is a follow up test for the protein elec...
  3. Recurrent Malignant Brain Tumours - Should I go for surgery or wait till they grow larger  (Answered) - Viewed 2372 times   I have seven malignant brain tumours should I get an operation now or wait till they grow larger and I will then need emergency ...
  4. carcinoid syndrome  (Answered) - Viewed 3601 times   i have got carcinoid syndrome,i am 54 years old,it is all over my abdome,in my eyes,in my liver,and i am awaiting results of a ...
  5. More info regarding previous question about colon cancer - Invasive grade 2 adenocarcinoma of the colon with invasion of pericolonic adipose tissue and venous involvement of the mesenteric margin of resection  (Answered) - Viewed 3492 times   Male, 58 years old, good physical condition, hypertension under control with meds, no heart problems; Invasive grade 2 adenocarc...
  6. Breaast Cancer - Pathology report shows two small tubular proliferations   (Answered) - Viewed 3992 times   This is the comment on my pathology report: My index of suspicion that the two small tubular proliferations repressent low grad...
  7. COLORECTAL - Colorectal cancer: PET Scan say not metastasis and no evidence of lymph  (Answered) - Viewed 2213 times   I have colorectal Cancer ,& it taken by operation 4 months ago took about 20 cm of the colon close to rectum . After operatio...
  8. investigations to rule out myeloma - Ruled out Myeloma but concerned about renal function  (Answered) - Viewed 3826 times   Hi, Sorry if i dont explain these lab results well. I cant understand the layout of the results on the form!Recently i went to t...
  9. LGPA - Mass noticed in mouth and sore appeared on the outside in the cheek area  (Answered) - Viewed 2080 times   My mum has an LGPA, originally found around 30 years ago, but not identified as anything serious and therefore not treated. Som...
  10. Stage III Multiple Myeloma IgA kappa light chain - Prognosis  (Answered) - Viewed 10274 times   Given the young age of onset, 53 years,and the advanced stage of the disease, Stage III Multiple Myeloma IgA kappa light chain, ...
  11. Would like insight into this unknown primary and ques. re; Pet scan for possible pancreatic CA  (Answered) - Viewed 3884 times   My mother had PET scan below skull to mid-thigh. Uptake is 3.5 in liver mets with liver to lesion background ratio of 2.0...and ...

 
What users are searching right now on Ask an oncologist now:
igglambdamonoclonalprotein     igg normal monoclonal peak     painlesslumponjawline     multiplelivercystsredpalmsofhands     biopsy20of20epiglottis     anal masterbation and cancer     puckering20of20stomach     sorenessabovebellybuttononrightside     histologic     whenyoupressonmystmachissoreandtenderwhy     knot20above20jawline     blood smear test     atypicalcellssuspiciousmalignancy     stoppingchemotherapy     kidney stones     igg20kappa20monoclonal20protein20bands     Lumpunderskinonneck     Pancreatic252520cancer     Iwanttoknowwhata     staging252520for252520multiple252520myeloma     spitting up slimy stuff     chronicmigraine     IgG252520IgA252520IgM     adnormal protien band 1 only test off     bonehemangioma     hiatal hernia     monoclonal20spike     is a female oncologist able to start a family and become a proper present mother     WhatdoesIgALambdamonoclonalproteindetectedinserumimmunofixationtestmean     reading20in20sauna20and20relationship20to20lung20cancer     nonhodgkins20lymphoma20and20lambda20monoclonial20cells     fnac20test20of20breast     how can you get lung cancer     i252520was252520diagonised252520with252520a252520brain252520tumor252520near252520the252520cerebellum252520but252520have252520no252520systoms     swollen20armpit20lymph20nodes     BenceJones20protein20symptoms     MALE 72 PSORIASIS AUTOPICAL DERMATISTS     with end stage liver cancer can your liver burst     IrregularMenstruation     is lung cancer dangerious     readinginsaunaandrelationshiptolungcancer     tumor20markers20breast20cancer20recurrance     Two252520Igm252520Monoclonal252520proteins252520electroparesis     lung haratomas and llung cancer     doeshavingfreekappalightchainsalwaysmeanmyeloma     cervical adenocarcinoma     kappa lambda light chain     How to lower cea irma     Whatcausesnoisesinthethroatthatsoundslikethroat     what does a high 1668 mean on immunoglobulin M On serum     canacancerpatienthaveafalsedeathwithnopulsethenbreatheagain     Below     MysisterwasdiagnosedwithStageBpancreaticcancelayearagoShehadasuccessfulWhippleanda3prongaggressivechemochemoradiationandchemotreatmentOnher3monthsurveillancevisittheCATscanshowed2spotsonherliver     lungcanceruntreated     thyroidcancerandrotatorcufftears     normalwbchighlymphocytesandlowgranulytespercentage     can20you20have20hodgkins20lymphoma20and20be20diagnosed20with20multiple20myeloma     What20food20and20drinks20to20eat20to20avoid20cea20irma20of20breast20caners     blader     whatdoesIgMkappamonoclonalproteindetectedinurineimmunofixationmean     linitusplastica     havingpregnancylikesymptomsbutnot     what20is20invasive20mamory20carsonoma20with20ductal20and20focal20features     st louis childrens hospital     search for answers     biclonal IGg Lambda     too20many20blood20cells20in20headbrain20symptoms     low platelets high lymphocytes     rheumatoid     needle252520biopsy252520inconclusive     abnormalprotienbands     upperthigh     Fiber     MRI bone scan     CAN20LUNG20CANCER20BE20REVERSED     Cytoxanandreturningperiods     asmalllumpontheupperrightsideofmyback     Al20Paul20Lefton20Company20Inc20marketing2020advertisinginternationalcom     drbrajansoncologistcontactnoinoman     endoxansideeffect     painful vein on penis     WHATISTHEMOSTCOMMONDISEASECAUSEDBYMONOCLONALPROTEIN     what20is20a20paracolic20tumor     namesdoctorshematolgyhemophiliaintorkya     Whatcausesahydroceleafterahernia     spine20cancer     nodulechin     radial20scar20breast     mysqladmin     25Gy     coloncancercolorectalcancerblackstoolpubicareapainpelvicandbackpain902resultchosennickname22drervitle223bregisteredregisteringonlymodeison3b     Is it normal for an oncologist to request to see a copy of the current will for an office visit     metastic20carcinoma     IG20Panel20Serum     nerve damage breast cancer     softtissuedensity     sternum20skin20bumps     Affiliated     whattreatmentisusedfortoomuchIgcKappamonoclonalprotein     Golf course     

©2011 - Ask an oncologist now  |  All Rights Reserved
The site is not a replacement for professional medical opinion, examination, diagnosis or treatment. Always seek the advice of your medical doctor or other qualified health professional before starting any new treatment or making any changes to existing treatment. Do not delay seeking or disregard medical advice based on information written by any author on this site. No health questions and information on askanoncologistnow is regulated or evaluated by the Food and Drug Administration and therefore the information should not be used to diagnose, treat, cure or prevent any disease without the supervision of a medical doctor. Posts made to these forums express the views and opinions of the author, and not the administrators, moderators, or editorial staff and hence askanoncologistnow and its principals will accept no liabilities or responsibilities for the statements made.

Home | Terms & Conditions | Contact Us | Frequently Asked Questions | Disclaimer | Privacy Policy | Advertise with us
Stats