Home   Recent Questions   Testimonials   FAQs


This question was answered on Sun 25, Apr 2010 02:23pm by bobby s, md

What is meant by havng an Abnormal Protein Band 1 (Protein-M) present?


    
Asked by smartguyjax (Male; 43; Hypertension, Herpes 2; Relevant drugs:Taking Micardis 40 mg / day for hypertension, Valtrex 500mg, Also taking 10mg of Buspirone and .25 mg of Xanax (Alprozolem) daily for anxiety/panic attacks every since I was exposed and recieved 1st Degree Chemical burns on my hands from to a cleaning Solution (Bar Keepers Friend) in Aug 2008 that contained Oxalic Acid. ) on Tue 20, Apr 2010 10:56pm

During recent neurological testing for the Neurological problems the M-Protein was detected with a High .3 g/dL level. The Vitamin B12 level was 376. The Serum Immunofixation results should a "Faint IGG (LAMBDA) Monoclonal Immunogobulin being detected. I have my first Oncology Appointment set for Friday 4/23/2010 to supposedly do a consult and find out next steps. Is a .3 G/DL level a concern, Is the faint LAMBDA level good or bad? Nothing on the report about the Kappa Level.

Actions: | Forward |
Answer


Name 

Email 

Security code
Enter the text as shown above


E-Mail me when someone replies to this post
Answer by bobby s, md  on Sun 25, Apr 2010 02:23pm:

Hi, As per our previous communication, I wish you good luck, and look forward to hearing about your further test results.

Detailed answer for your question: Available in paid version. - Click to pay.
Second opinion from another doctor: Available in paid version. - Click to pay.
               
Our doctors provide free answers to your questions. If you are happy with our services, please consider making a donation.
Click the button below to donate.


Please rate my answer (select the stars, no need to log in.)  

Comments:

Comment by Marie McCann on Thu 22, Sep 2011 01:37pm: I have an abnormal protein Band 1 level of .4 My Doctor does not seem to be concerned . Should I seek a second opinion?

This question is open for comments.  Please share your opinion.

Comments


Name 

Email 

Security code
Enter the text as shown above


E-Mail me when someone replies to this post
Other cancer questions you might be interested in.
  1. Possible lung cancer with mets to cerebellum - MRI of the brain and CT of lungs ordered: Chances of having cancer  (Answered) - Viewed 3157 times   I just went to my neurologist. Because of gait abnormalities and history of essential tremors, he has ordered an MRI of the brai...
  2. possibility of MM?  (Answered) - Viewed 2434 times   I had a cbc done on 02/11/08 because of a tooth infection and a bad cold. ( I had a root canal done the following week). On 3/16...
  3. Serum Immunofixation test result - What does IgG Kappa monoclonal protein detected in serum immunofixation test mean?  (Answered) - Viewed 83992 times   What does IgG Kappa monoclonal protein detected in serum immunofixation test mean? This is a follow up test for the protein elec...
  4. Breast cancer - Puckering and dimpling of skin on both breasts  (Answered) - Viewed 17000 times   What is meant by 'puckering and/or dimpling' of the skin? I have just done a breast self-exam and when I sit down, put my arms a...
  5. carcinoid syndrome  (Answered) - Viewed 3666 times   i have got carcinoid syndrome,i am 54 years old,it is all over my abdome,in my eyes,in my liver,and i am awaiting results of a ...
  6. bowel cancer - Survival rate for lung cancer  (Answered) - Viewed 2874 times   my husband had surgery for lung cancer 18 months ago, the cancer was removed, six weeks ago he was rushed into hospital as his b...
  7. stage 3 colon cancer - chances of recurrence and treatment options  (Answered) - Viewed 4406 times   In July of 2007 my husband had a colon resection done with about 1.5 feet of his colon removed due to stage 4 colon cancer (sigm...
  8. 5 year survival rate - Just finished Chemotherapy for Stage III colon cancer  (Answered) - Viewed 3653 times   What does "5 year survival rate" mean? My husband just finished chemo for stage 3 colon cancer, after he had a colon resection ...
  9. pancreatic cancer - Pain in the right upper side of abdomen, bad headaches.  (Answered) - Viewed 14973 times   my sister has been going to a gasterologist because of pain in her upper right side of abdomen. He has ruled out cushing and ch...
  10. Colon Cancer.....still tired after chemo ended 01/20/2008 - Is my husband tired of chemotherapy?  (Answered) - Viewed 2245 times   My husband finished 12 chemo treatments for colon cancer on 01/12/2008(every other week). He is still very tired and needs to s...
  11. Breast+cancer - Treated with radiation and chemotherapy: Should the tumor be removed?  (Answered) - Viewed 2457 times   A friend of mine was diagnosed with breast cancer. She commented that she cancer had spread to her lymph nodes but that she was ...

 
What users are searching right now on Ask an oncologist now:
PTEN     Omasom     bartholinscarcinomalymphoma     asklungcancerquestions     lumponmyribcage157220inurl20post20a20new20comment20lipoma     is20it20safe20to20take20vitamin20tablets20whilst20having20chemo     Search for answers     Search for answers     i20have20been20diagnosed20with20atypical20ductal20hyperplasia20will20my20sons20need20to20be20concerned     Search for answers     Search for answers     lymphoma     Search for answers     Search for answers     Search for answers     Search for answers     bukol a cancerous ba     recurrence     CSF20PROTEIN     liver cyst     search     1     search     IgMkappamonoclonalbandpresent     iga monoclonal protein with lambda lihtchain     temperature and shivers with overian cancer     Search for answers     What20is20invasive20mammary20carcinoma20with20intermixed20lymphocytes     bile20duct20hamartoma     Alpha20120in20urine     columnar metaplasia     Tailbone pain and prostate cancer     igm monoclonal kappa     Search for answers     Search for answers     Search for answers     Search for answers     vaginaandrectumlump     ihavealwayshadaverypaleraisedmole     chancesofsurviving     trombocitopenia     angiosarcoma     mainstream20smoke     is20a20vascular20mass20in20neck20cancer     askhead20neckcancerquestions     ca19252520bloating     waiting20for20lumpectomy     shape stool     Lungnodule     hodgkin     Lump in breast painful breast     abnormal20pap     asklungcancerquestions     Epstein20Barr20Virus     abilify     beta pe1     beta pe1     MyDrrecommendsTC     pilinodalcystandscubadiving     bladder mass     askstomachcancerquestions     multiplemyelomaperipherialneuropathy     breast20cancer201420x201420cm     monoclonalproteinband     borderline     ill20defined20igg20lamda     monoclonal gammopathies     serum20beta20microgobulin20test     side     anal masturbation     free lambda     askovariancancerquestions     whatdoesfreelambdalightchainmean     polycystic ovaries     broad Gamma band     My20husband20has20had20520weeks20of20radiation20and20chemo20for20pancreatic20cancer20that20is20localized20not20spread20has20to20wait20520weeks20before20ct20scanstomach20hurts20all20the20time20is20this20normal20Also20stool     lymphoma20mono     multiplemyelomasymptoms     Igm20Kappa20two20proteins20on20immunofixation     10 yr old son with blood 1125     swollenlymphnodesonleftsideofnecj2548 Result chosen nickname weappyAlkappyYUHHBNMK registered registering only mode is ON     Livercancer     asklungcancerquestions     asklungcancerquestions     login     StageIIIMultipleMyelomaIgA     LUMPLumpinthebackofne     sore on side of my clitorus     puckeringonskin     ewingsarcoma     what is a lung cancer     does everyone have cancer cells in their bodies     TwoIgmMonoclonalproteinselectroparesis     asklungcancerquestions     asklungcancerquestions     bartholins20cysts     electrophorosis252520is252520for252520252520what     Search for answers     Search for answers     lymph20node20stage20420lung20cancer     

©2011 - Ask an oncologist now  |  All Rights Reserved
The site is not a replacement for professional medical opinion, examination, diagnosis or treatment. Always seek the advice of your medical doctor or other qualified health professional before starting any new treatment or making any changes to existing treatment. Do not delay seeking or disregard medical advice based on information written by any author on this site. No health questions and information on askanoncologistnow is regulated or evaluated by the Food and Drug Administration and therefore the information should not be used to diagnose, treat, cure or prevent any disease without the supervision of a medical doctor. Posts made to these forums express the views and opinions of the author, and not the administrators, moderators, or editorial staff and hence askanoncologistnow and its principals will accept no liabilities or responsibilities for the statements made.

Home | Terms & Conditions | Contact Us | Frequently Asked Questions | Disclaimer | Privacy Policy | Advertise with us
Stats