Home   Recent Questions   Testimonials   FAQs


This question was answered on Sun 30, Mar 2008 02:10am by Dr Heinrik M, MD

hard lung disease - Treatment for hard lung cancer: Work in environment where there are heavy smokers


    
Asked by shirley (Male ) on Fri 28, Mar 2008 05:30pm

my oxgen level in my blood runs about 97-99 however in taking a breathing test my doctor has indicated i am running at about 50% capicity we are trying an inhaler to see if there is a problem he indicated it might be hard lung what are treatments for this i am and always have been a non smoker but worked in environments where there were many heavy smokers cancer was never mentions can you help me or tell me where to look that you

Actions: | Forward |
Answer


Name 

Email 

Security code
Enter the text as shown above


E-Mail me when someone replies to this post
Answer by Dr Heinrik M, MD  on Sun 30, Mar 2008 02:10am:

Hi, Iím afraid hard lung is not a technical term. It may mean infection, irritant scarring, or malignancy. It may be important to obtain a sample of the lung, through a needle taken through the chest, or through a scope inserted through the mouth or nose. From this sample, the behavior of the disease will be determined and available treatment can be offered to you. A visit to a lung specialist/pulmonologist may be the first step.

Detailed answer for your question: Available in paid version. - Click to pay.
Second opinion from another doctor: Available in paid version. - Click to pay.
               
Our doctors provide free answers to your questions. If you are happy with our services, please consider making a donation.
Click the button below to donate.


Please rate my answer (select the stars, no need to log in.)  

This question is open for comments.  Please share your opinion.

Comments


Name 

Email 

Security code
Enter the text as shown above


E-Mail me when someone replies to this post
Other cancer questions you might be interested in.
  1. I am coughing often but never smoked -- do I need to be checked for lunc cancer?  (Answered) - Viewed 3687 times   I am a 41 year old healthy non smoker (well.. I am smoking a cigar every month but that's it) but I find myself coughing fairly ...
  2. Possible lung cancer with mets to cerebellum - MRI of the brain and CT of lungs ordered: Chances of having cancer  (Answered) - Viewed 3468 times   I just went to my neurologist. Because of gait abnormalities and history of essential tremors, he has ordered an MRI of the brai...
  3. pain meds versus liver damage  (Answered) - Viewed 5171 times   My 57yo brother in law was diagnosed in October with lung cancer with mets to the bones, brain and liver. His lung ca was Stage...
  4. Lung adenocarcinoma of a scar left by a past asymptomatic histoplasmosis infection in a nonsmoker 79yr female  (Answered) - Viewed 2991 times   What is the time line and occurrence of lung scarring and calicification of lymph nodes from a previous Histoplasmosis infection...
  5. Nodule found on Lung  (Answered) - Viewed 3717 times   This morning, during a routine x-ray to determine if I had pneumonia or bronchitis, the technician noticed what he thought might...
  6. Herceptin - Diagnosed with metastatic breast cancer. How long do I stay on Herceptin?  (Answered) - Viewed 4670 times   I am a 51 yr.old woman with history of metastic breast cancer which was originally diagnosed in 2000. I am her 2 neu positive, e...
  7. stages of cancer - Stage IV cancer in the adrenal gland near top of kidney  (Answered) - Viewed 3344 times   my father-in-law has stage 4 cancer in the adrenal gland near top of kidney due to cancer from his lung. how many stages of can...
  8. Pancreatic Tumour - Tumour found on Pancreas only head left visible on CT Scan  (Answered) - Viewed 2876 times   Tumour found on Pancreas only head left visible on CT Scan, matasized to lungs and Liver and possibly bowel. We are wondering wh...
  9. carcinoid syndrome  (Answered) - Viewed 3943 times   i have got carcinoid syndrome,i am 54 years old,it is all over my abdome,in my eyes,in my liver,and i am awaiting results of a ...
  10. bowel cancer - Survival rate for lung cancer  (Answered) - Viewed 3145 times   my husband had surgery for lung cancer 18 months ago, the cancer was removed, six weeks ago he was rushed into hospital as his b...
  11. SPN with family history of lung cancer -Diagnosed with a solitary pulmonary nodule in right upper lobe  (Answered) - Viewed 3464 times   I am a 50 year old female non-smoker. I have been diagnosed with a solitary pulmonary nodule in my right upper lobe. It is des...

 
What users are searching right now on Ask an oncologist now:
lump and leaasiok om kower lef brest     cooloidal20skin20disease     cream to use in mouth sores during chemo     cancerwithinthevaginaiscalled     why cant secondard bone cancer be cured     IgGandIcMlow     hypoechoicwelldefinedmassesinrightpericavalregionmajoursabput5027cms     allergicreactiontopeanutr     esophagealcancer     lumpparotidgland     smalllumponmyanus     Dyspepsia     What252520is252520mdct     swallow     I20HAVE20LUMP20TO20RIGHT20OF20PENIS     dermoid cyst of frontal lobe     teenagerlungcancer     lumpunderchein     multiplemyelomaandamyloidosis     COLONCANCERANDABCESSONTAILBONEAnyspecialistwho     kappa light chain long survival     adenocarcinoma20de20pulmon20de20celulas20no20pequenas     back     lymphoma     stages     anaplasticoligoastrocytomag     i20have20been20diagnosed20with20atypical20ductal20hyperplasia20will20my20sons20need20to20be20concerned     charmeacademy     cbc20tests     pancoast20lung20tumour20prognosis     her2neuandprevioususeofbirthcontrolpills     increasedkappalambda     lung20density     to20Igm20Kappa20Clones     Peripheral20neuropathy     hpvandanalcancer4921 Enter your comments here Let me see     intestinal     puckeringonstomachwall     PMA     stage II zero lymp node of right colon cancer what is the manner of treatment     retroperitoneal     multinodalcabceruterieffectivetreatmentoflymphost     IgM monoclonal protein with lambda light chain specificity     a20faint20iga20lambada     How long can a person survive with lung cancer and pnuemonia     signs20of20lymphoma     askbreastcancerquestions     askbreastcancerquestions     1gG     mainstream     IS COBALT GIVE CHANCE TO OVARIAN CANCER PATIENT SURVIVE     whatdoavalueof14533say     pepic ulcer disease     ItchingCouldthisbelymphomaOnlysymptomisconstantitchingsensationall297Itching     two IgM Kappa Proyeins     bile duct     ovary pain     mesenteric20lymph20node     Tailbone pain and prostate cancer     where do you train or study     blood20semen     what can a teenager do to contract his breast     Ritalin     IgG Lambda monoclonal protein     Search for answers     Search for answers     Search for answers     Search for answers     ductalcarcinomawithlobular     lung20density     increasedkappalambda     her2neuandprevioususeofbirthcontrolpills     pancoast20lung20tumour20prognosis     cbc20tests     charmeacademy     intestinal     i20have20been20diagnosed20with20atypical20ductal20hyperplasia20will20my20sons20need20to20be20concerned     anaplasticoligoastrocytomag     stages     lymphoma     back     adenocarcinoma20de20pulmon20de20celulas20no20pequenas     kappa light chain long survival     COLONCANCERANDABCESSONTAILBONEAnyspecialistwho     multiplemyelomaandamyloidosis     lumpunderchein     teenagerlungcancer     what20is20a20cyst     tubbis     breast20cancer20an20ideal20protein20program     ERPRNEGATIVEHER2NEUPOSITIV     temperature     SwollemlymphnodesEpsteinBarrtiredwartscandida     bilateral252520hilar     hcgandcancer     highlymphocyteand     anuangginagamotngoncologist     howislungcanceridentified     Heart20feels20like20it20is20being20squeezed     gammaknifeafterwbr     

©2011 - Ask an oncologist now  |  All Rights Reserved
The site is not a replacement for professional medical opinion, examination, diagnosis or treatment. Always seek the advice of your medical doctor or other qualified health professional before starting any new treatment or making any changes to existing treatment. Do not delay seeking or disregard medical advice based on information written by any author on this site. No health questions and information on askanoncologistnow is regulated or evaluated by the Food and Drug Administration and therefore the information should not be used to diagnose, treat, cure or prevent any disease without the supervision of a medical doctor. Posts made to these forums express the views and opinions of the author, and not the administrators, moderators, or editorial staff and hence askanoncologistnow and its principals will accept no liabilities or responsibilities for the statements made.

Home | Terms & Conditions | Contact Us | Frequently Asked Questions | Disclaimer | Privacy Policy | Advertise with us
Stats