Home   Recent Questions   Testimonials   FAQs


This question was answered on Tue 11, May 2010 07:29pm by rrkrishn

lump on clitoris


    
Asked by Unregistered (Female; 17; YES; clear; Relevant drugs:none ) on Mon 10, May 2010 11:05am

Hi, Its very embarrassing, but about a month or so ago a lump appeared on my clitoral hood. It is hard like a stone and i can move it around. It becomes itchy if i wear tight clothing and sometimes have to sleep with no bottom half on as it becomes too irritable. It is clearish and looks slightly like a wart, but it isnt genital warts because i checked out those symptoms and saw a picture and it did not look like the picture.I have not got a clue what it could be. I am sexually active, with another female, but she has never had a sexual partner before so i can't see how it could be an STI. I had sex a year ago and not since. Is there a possibility that I have done it by masturbating? I sometimes use the shower head and put the jets on my clitoris, could this have caused the lump? I have tried using thrush cream on it but this had no effect.

Actions: | Forward |
Answer


Name 

Email 

Security code
Enter the text as shown above


E-Mail me when someone replies to this post
Answer by rrkrishn  on Tue 11, May 2010 07:29pm:

Hi, This could be a Bartholin's abscess or cyst. There are glands in the vaginal lips called Bartholinís glands. These can become painful and swollen, and an abscess can form. This often causes blockage in the main duct from the gland, and a cyst develops. This is felt as a painless, hard swelling. In such cases, antibiotics may be helpful, or surgical treatment might be required. Other possibilities are boil, sebaceous cysts, etc. The only way to know the confirmed cause is a clinical examination by an OBG specialist. Regards.

Detailed answer for your question: Available in paid version. - Click to pay.
Second opinion from another doctor: Available in paid version. - Click to pay.
               
Our doctors provide free answers to your questions. If you are happy with our services, please consider making a donation.
Click the button below to donate.


Please rate my answer (select the stars, no need to log in.)  

This question is open for comments.  Please share your opinion.

Comments


Name 

Email 

Security code
Enter the text as shown above


E-Mail me when someone replies to this post
Other cancer questions you might be interested in.
  1. Breast cancer - Puckering and dimpling of skin on both breasts  (Answered) - Viewed 20131 times   What is meant by 'puckering and/or dimpling' of the skin? I have just done a breast self-exam and when I sit down, put my arms a...
  2. Bladder cancer - rusty colored slough, pressure in low abdomen and unable to start stream sometimes  (Answered) - Viewed 4901 times   I was diagnosed a week ago with bladder cancer. Occasional bright red blood in urine over the last 3 months Over the last seve...
  3. carcinoid syndrome  (Answered) - Viewed 4617 times   i have got carcinoid syndrome,i am 54 years old,it is all over my abdome,in my eyes,in my liver,and i am awaiting results of a ...
  4. Enlarged lymph nodes - sign of secondary lymph node cancer?  (Answered) - Viewed 5312 times   Diagnosed with breast cancer in 2000 and DCIS in other breast 2001. Mastectomy, chemotherapy, radiotherapy. 4 weeks ago I h...
  5. breast lump in the elderly - Should lumps be removed regardless if it is cancer?  (Answered) - Viewed 3452 times   my grandmother, age 95, has recently had a needle biopsy of a lump in her breast. She will go back soon to be told if it is canc...
  6. Carcinoid Cancer - Multiple locations : misdiagnosed with triple negative breast cancer  (Answered) - Viewed 5654 times   September 07 I was misdiagnosed with triple negative breast cancer. I received 10 mega doses of radiation through a mammosite, O...
  7. cancerous breast tissue? - Cancerous tissue in breast:: Is it Stage I breast cancer   (Answered) - Viewed 3861 times   my mom has just found out that she has cancerous tissue in her breast but no lump is cancerous tissue the first stage in cancer ...
  8. Something in my throat - Lump in my throat?  (Answered) - Viewed 4793 times   I feel like something is stuck in my throat. But I know Its not something, its like a lump or something? What could this be, It ...
  9. Please help me with an answer - Enlarged glands under left side of jaw and under ear  (Answered) - Viewed 6840 times   For the last four months i have had enlarged glands i have two under the left side of my jaw and one on the right side the both ...
  10. What do you think? please - Cells after biopsy were high grade with necrosis  (Answered) - Viewed 3734 times   Hi, I had 5mm dcis - had a lumpectomy and there was 1mm found close to the edge of the margins. The doctor thought maybe more h...
  11. PAPILLARY THRYOID CANCER - Any other treatment for papillary thyroid cancer other t han biopsy  (Answered) - Viewed 3095 times   MY MOM WAS DIAGNOSED WITH PAPILLARY THYROID CANCER 2 YEARS AGO, SHE HAS HAD 2 TREATMENTS OF I-131, AFTER THEY REMOVED HER THYROI...

 
What users are searching right now on Ask an oncologist now:
SOFT     Mons     What20is20invasive20mammary20carcinoma20with20intermixed20lymphocytes     Igm     Prostate Cancer     waldenstrom     IgM20kappa     NonHodkin20Lymphoma     what20is20hard20lung     Could     Result20ede520ede0f8ebeef1fc20f4eef0ecfb20e4ebff20eef2eff0e0e2eae83b     H20pylori20and20mass20on20groin     1gg kappa band     Kidney20Cancer     monoclonal spike     pelvic20ex     Search for answers     Search for answers     Search for answers     Search for answers     mymotherinlawhasbeendiagonisedwith     Search for answers     Search for answers     hadendscopyeverythingisclearednocancernoscartissuebutitstillsfeelslikesomethingisstuckinmythroat     breast cancer chemo ct scan results nodular lun     goiter treatment     SEX     product_results     iga slightly high     high absolute neutrophil count     lottcellcount     a     hard252520lump252520on252520the252520back252520of252520my252520neck252520below252520hairline     ask the md     iGg20kappamonoclonal     CSF20PROTEIN     php     Itchyburningskinalloverforabout20monthsWhatisprobabilitythisiscomingfromHodgkins37720Result20registered20registering20only20mode20is20ON     ctscan     Alpha fetoprotein and liver cysts     adenacorsinom     contraceptive device after cancer     whataresometreatmentstolungcancer     IgG lamba protein in urine     scf concentrated 80x reveal a trace of immunofixation igg kapa monoclonal imunoglobulin migrating in the gamma region     severe coughingxray showed 8 mm noduleare they related     adenocarcinoma     rence     whatisthedeathrateformultiplemyeloma     what causes calcium spots on lower back and arms     faintiggkappamonoclonalim     teeth     ConfusingSy     elevated prolactin     Why does aramotose inhibitors cost so much     isthebrca1generesponsibleforleiomyosarcoma     Cancerpatientssurvivorsandfoot     when i did not release durin romantic activity dose it mean i am suffering from delayed ejaculation     questiontoaskdoctorafterliversurgery     Chemo20dads     igG normal monoclponal peak     IgG lambda multiple myeloma     IgG20lamba20protein20in20urine     Searchforanswer     Isneutropeniaandleukopeniaseenin     increased20polycolonal20gammopathy20IgM     ihavealwayshadaverypaleraisedmole     igg lambda band present     soft     all quistions     igglambdamonoclonalpeak     Cancerpatientssurvivorsandfoot     flesh20colored20lump20on20tonsil     how we know which organ is first affected if the tumor metastasize     lungcancerandlegpain     small20cluster20microcalcifications     multiple myeloma igg kappa     anal252520masterbation252520and252520cancer     cea20breast20cancer     is testicular cancer painful     frequent fever associated with severe headache and menstrual cramps     schedule of oncologist     surgery252520or252520chemo252520first     how long with treatment can a person live with extensive small cell lung cancer     lump on clavicle     fgff yy rhhjt445     Coulditbe     immunofixation20protein     Search for answerswhat do Faint band in IgM and Lambda is present against a dense polyclonal backgroundmean     BiCNU     Search for answers     Search for answers     stage iv lung cancer     Search for answers     Search for answers     Search for answers     breast cancer histoplasmosis     bumps20on20mons20pubis     multiple myeloma symptoms     lymphoma symptoms     

©2011 - Ask an oncologist now  |  All Rights Reserved
The site is not a replacement for professional medical opinion, examination, diagnosis or treatment. Always seek the advice of your medical doctor or other qualified health professional before starting any new treatment or making any changes to existing treatment. Do not delay seeking or disregard medical advice based on information written by any author on this site. No health questions and information on askanoncologistnow is regulated or evaluated by the Food and Drug Administration and therefore the information should not be used to diagnose, treat, cure or prevent any disease without the supervision of a medical doctor. Posts made to these forums express the views and opinions of the author, and not the administrators, moderators, or editorial staff and hence askanoncologistnow and its principals will accept no liabilities or responsibilities for the statements made.

Home | Terms & Conditions | Contact Us | Frequently Asked Questions | Disclaimer | Privacy Policy | Advertise with us
Stats