Home   Recent Questions   Testimonials   FAQs


This question was answered on Tue 17, Aug 2010 11:14pm by Dr.Ravindra Rajput

third testicle


    
Asked by Unregistered (Male; 15; YES ) on Mon 16, Aug 2010 08:37pm

ok i didnt do anything about this cause i wasnt sure what it was because im almost positive its not testicular cancer i have like a third ball growing on my left testicle its not a bump its like connect almost makes like a 8 the ball is like 1/3 the size of my actual testicle any advice by the way im 15 if that has anything to do i noticed it when i was 14 and the ball didnt get any bigger.

Actions: | Forward |
Answer


Name 

Email 

Security code
Enter the text as shown above


E-Mail me when someone replies to this post
Answer by Dr.Ravindra Rajput  on Tue 17, Aug 2010 11:14pm:

Hi, painless conditions for lump include Hydrocele, Varicocele Spermatocele, Epididymal cyst and Testicular tumor. Flesh colored bump indicates testicular tumor (important to rule out cancer). Hernia may be another possibility. A urinalysis also should be performed since pyuria and/or bacteriuria suggest an infectious etiology such as epididymitis. Firstly, you need to undergo radio imaging like color Doppler or MRI to rule out the cause and extent of the Color Doppler imaging of the scrotum and biopsy of lump may add as adjunct for diagnosis. I suggest you to consult a surgeon. Take care and regards.

Detailed answer for your question: Available in paid version. - Click to pay.
Second opinion from another doctor: Available in paid version. - Click to pay.
               
Our doctors provide free answers to your questions. If you are happy with our services, please consider making a donation.
Click the button below to donate.


Please rate my answer (select the stars, no need to log in.)  

This question is open for comments.  Please share your opinion.

Comments


Name 

Email 

Security code
Enter the text as shown above


E-Mail me when someone replies to this post
Other cancer questions you might be interested in.
  1. Do i have testicular cancer?   (Answered) - Viewed 4426 times   I noticed a pain in my left testicle. The pain becomes terrible sometimes and it shoots up into my lower stomach. I noticed a sm...
  2. Testicular periphery - small, persistent masses that do not change in size - have had them for a number of +years.  (Answered) - Viewed 1968 times   Does testicular cancer present ON the testicle itself rather than in the peripheral tissues? I have a small granule within each ...
  3. husbands testicle has been hurting, last night he found a bump on it, is it cancer?  (Answered) - Viewed 1711 times   My husband's testicle had been hurting off and on for a month or so. Last night, he found a lump/bump on the testicle, not the s...
  4. Left testicle is hurting... Is it something serious or should I let it be? Please help!!!  (Answered) - Viewed 5255 times   Hello, I have noticed in the past few days that my left testicle has been hurting. At times I have lower left abdominal pain and...
  5. burning Pain/Discomfort and small lump on left testicle  (Answered) - Viewed 2517 times   Hi. i recently had pain in my left testicle upon examining it i felt a little lump. i got examined by my doctor and he said that...
  6. Prostate Cancer  (Answered) - Viewed 1547 times   My husband (african american) was diagnosed with early stage of prostate cancer in March 2008. He has had one hormone injection...
  7. prostate cancer and bladder cancer also prostatitis and benign prostatic hyperplasia  (Answered) - Viewed 1773 times   I wan't to know that if a person have had chronic microscopic hematuria for six years and still have it today but during that t...
  8. blood in my semen  (Answered) - Viewed 1495 times   I have blood in my semen. I seen the doctor and he gave me some anti bactirials. He said that if it doesn't go way that I may ne...
  9. Testicle missing since age 9  (Answered) - Viewed 1298 times   Hello I am a 17 year old boy. When i was around 9 years old i woke up one morning and noticed my right testicle was missing. I h...
  10. Hi, I am a 29 yro, male & I have had an ache or pain progessivly becomming worse in my left testicle. also it is slightly undecended and is sensitive to the touch. My lower back achs as well and the lower left part of my abdomen just above my pubic bone a  (Answered) - Viewed 1782 times   Hi, I am a 29 yro, male & I have had an ache or pain progessivly becomming worse in my left testicle over the last month. Also i...
  11. Symptons of testicular cancer  (Answered) - Viewed 1522 times   Hi, Can you confirm if a sympton on testicular cancer is to have constant diahheria? I also have a dull ache in my testicl...

 
What users are searching right now on Ask an oncologist now:
pilinodal cyst     howcanihelpmyshelf     broad20Gamma20band     igg20kappa     throat20noises20while20asleep     thoracic cancer     mesothelioma law firms     igm kappa monoclonal protein     does having free light kappa chains in the high normal range mean myeloma     i20feel20dizziness2020lump20in20my20throat     ctscanshoweddark     Heart feels like it is being squeezed     amyloidosis     what is ur free lambda mean when found in urine     IgG252520IgA252520IgM     faint ImG monoclonal immunogloblulin     IgGkappamonoclonalbands     the treatment of skin disease     is20lung20cancer20dangerious     chronic lymphocytic leukemia     mild enhancement     mgusigglambdaspike     ovary ovarian     collarbone trauma and swollen lymph node     bladder252520cancer     primary20myelofibrosis     immunoglobulingaandmqn     immunoglobulin     immunofixation20studies20revealed20two20trace20concentration20bands20migrating20in20the20gamma20region20which20appear20as20igg20lambda20monoclonal20protein20what20does20this20mean     immunofix20Electrophor20gel     breastmasscolorsBreastbiopsysayscancerouswithcolorofmassdarkpink127breast     iliac     ill defined positive immuno fixations     ihavethislumpundermyrightearlobeandbehindmyjaw     ihavejustnoticedasmallsoftlu     ihavefoundtwosmalllumpsonmyinnerliponmyvirgin     ihaveasmallwhite     ihaveapainfullumpinmyrightbreast     ihaveapainfullump     ihavealumpswelling     ihaveal     igotalivercystislivercystdan     igmmonoclonalproteinwithlambdalightchainspecificity     igmlambda     igmkappa27mgl     igm252520monoclonal     igm20monoclonal20protein20with20kappa20light20chain     igm20kappa20monoclonal20immunoglobulin     igm20kappa     igm kappa 27 mgl     iggnormalmonoclponalpeak     iggnormal     igglambda     iggkappamonoclonalproteindetectedigg     iggkappamonoclonalimmunoglobulin     iggkappalymphoma     igg20kappa20monoclonal20band20present     igg20gamma20monoclonal20protein     igg monoclonal protein with lambda light chain specificity explanation     igg lamda     igg lambda trace     igg lambda     igg kappa with normal lambda     igg kappa monoclonal protein detected igg     igg     igakappamonoclonalproteininblood     2 bands of igg lambda     iga slightly high     iga kappa monoclonal protein in blood     iga 413     igG20LAMBDA20MONOCLONAL20PARAPROTEIN20MIGRATING20IN20THE20MID20GAMMA20REGION20WHAT20DOES20THIS20MEAN     ifyouhavealumpectomydoesitmeansyouhavecancer     ife20serum     if you have been diagnosed with bile duct cancer and your liver is 60 affected what is the prognosis     if i have free kappa light chain in the high normal range do i have myeloma     icd9codeforiggfaintkappaband     icd9 code for igg faint kappa band     breast cancer stage 1 no lymph node er PR her2     iamdiabeticandhighbloodpressurehadatotalmasectomynowne     iamdiabeticandhighbloodpressureh     iaman18yroldsexuallyactivegirlaboutamonthagoifoundalu     i252520was252520diagonised252520with252520a252520brain252520tumor252520near252520the252520cerebellum252520but252520have252520no252520systoms     i20have20only20burning20tongue20from20last20one20month20and20no20other20symptoms20it20can20be20a20oral20cancer     i20have20a20blister20like20thing20below20my20gumline20behind20my20bottom20teeth20what20could20this20be     gamma glutamylttransferase     breast cancer grade 3 chemo or not     asklungcancerquestions     CanItaketamoxifenandhcg     i have stage 4 metastatis breast cancer to the lung how long do i stay on herceptin     i have bad bllod loss from my vigina its just gushing away from me and i have lost some big black clots and what seems to be flesh im still badly bleeding has been 24 hours now     i had syphilis got treatment but im still dripping     hypoechoicwelldefinedmassesinrightpericavalregionmajoursabput5027cms     hypodensemassofsuperiormediastinum     hyperthyroid and left neck mass     hypertention why is it important public heathy     hyaluronic     httpwwwmvdenzlingendegbkimagessmiliesabiumi     hpvandanalcancer4921Enteryourcommentshereexchange     hpvandanalcancer492120enter20your20comments20here20possibly     hpvandanalcancer492120enter20your20comments20here20exchange     

©2011 - Ask an oncologist now  |  All Rights Reserved
The site is not a replacement for professional medical opinion, examination, diagnosis or treatment. Always seek the advice of your medical doctor or other qualified health professional before starting any new treatment or making any changes to existing treatment. Do not delay seeking or disregard medical advice based on information written by any author on this site. No health questions and information on askanoncologistnow is regulated or evaluated by the Food and Drug Administration and therefore the information should not be used to diagnose, treat, cure or prevent any disease without the supervision of a medical doctor. Posts made to these forums express the views and opinions of the author, and not the administrators, moderators, or editorial staff and hence askanoncologistnow and its principals will accept no liabilities or responsibilities for the statements made.

Home | Terms & Conditions | Contact Us | Frequently Asked Questions | Disclaimer | Privacy Policy | Advertise with us
Stats